{"product_id":"proteintech-68227-1-ig","title":"Proteintech, 68227-1-Ig, FABP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FABP1 (68227-1-Ig) by Proteintech is a Monoclonal antibody targeting FABP1 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples\n68227-1-Ig targets FABP1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue, pig liver tissue,  mouse liver tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse liver tissue, mouse brain tissue\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFABP1, liver fatty acid-binding protein, is abundant in cytoplasm that regulates lipid transport and metabolism. It plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PMID:25732850). FABP1 is mainly expressed in hepatocytes, enterocytes and to a lesser degree in renal tubular cells, associated with liver injury (PMID: 15653098). Levels of FABP1 was elevated in patients with hepatocyte injury secondary to alcohol or drug toxicity (PMID: 14563446).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag32836 Product name: Recombinant human FABP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-127 aa of BC032801 Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Predict reactive species\nFull Name: fatty acid binding protein 1, liver\nCalculated Molecular Weight: 127 aa, 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC032801\nGene Symbol: FABP1\nGene ID (NCBI): 2168\nRRID: AB_2935315\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P07148\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888275968169,"sku":"68227-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68227-1-ig","provider":"Iright","version":"1.0","type":"link"}