{"product_id":"proteintech-68244-1-ig","title":"Proteintech, 68244-1-Ig, CBX2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CBX2 (68244-1-Ig) by Proteintech is a Monoclonal antibody targeting CBX2 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n68244-1-Ig targets CBX2 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293 cells,  HeLa cells,  Jurkat cells,  K-562 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe chromobox homolog protein 2 (CBX2) is a critical component of the PRC1 complex involved in antiviral innate immunity, neuronal, and gonadal differentiation, axial patterning during embryonic development, cell proliferation, and senescence (PMID: 32870972). CBX2 has 2 isoforms with the molecular mass of 23 and 56 kDa. Sometimes higher molecular weight around 65-70 kDa can also be observed, which may be a modified variant of CBX2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8311 Product name: Recombinant human CBX2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-211 aa of BC004252 Sequence: MEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKVGGCAGYADPTSQHPLGVGGRQREGLGPSGRGWHFCQQSVPLLGKQEPPFFLSLSFCCQGPQPAESSSPPLPGASCFSLSCTPLCWVAGSNCCRQALFPPRGSLGDGKEQEACVQ Predict reactive species\nFull Name: chromobox homolog 2 (Pc class homolog, Drosophila)\nCalculated Molecular Weight: 56 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC004252\nGene Symbol: CBX2\nGene ID (NCBI): 84733\nRRID: AB_2935331\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q14781\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888104919209,"sku":"68244-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68244-1-ig","provider":"Iright","version":"1.0","type":"link"}