{"product_id":"proteintech-68249-1-ig","title":"Proteintech, 68249-1-Ig, PDCD2L Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDCD2L (68249-1-Ig) by Proteintech is a Monoclonal antibody targeting PDCD2L in WB, IF\/ICC, ELISA applications with reactivity to Human samples\n68249-1-Ig targets PDCD2L in WB, IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, LNCaP cells,  HCT 116 cells,  HeLa cells,  K-562 cells,  HepG2 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDCD2L was aberrantly expressed in multiple types of human cancers, and associated with clinical stage and molecular subtype and PDCD2L could be served as a biomarker of CRC (PMID: 35216602).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30807 Product name: Recombinant human PDCD2L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 80-179 aa of BC006146 Sequence: CACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVP Predict reactive species\nFull Name: programmed cell death 2-like\nCalculated Molecular Weight: 358 aa, 39 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: BC006146\nGene Symbol: PDCD2L\nGene ID (NCBI): 84306\nRRID: AB_3085049\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9BRP1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888308932777,"sku":"68249-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68249-1-ig","provider":"Iright","version":"1.0","type":"link"}