{"product_id":"proteintech-68263-1-ig","title":"Proteintech, 68263-1-Ig, POLR3D Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe POLR3D (68263-1-Ig) by Proteintech is a Monoclonal antibody targeting POLR3D in WB, FC (Intra), ELISA applications with reactivity to human, rabbit samples\n68263-1-Ig targets POLR3D in WB, FC (Intra), ELISA applications and shows reactivity with human, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, rabbit brain tissue,  K-562 cells,  HEK-293 cells,  HeLa cells,  Jurkat cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Polymerase (RNA) III (DNA directed) polypeptide D(POLR3D) plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses and acts as nuclear and cytosolic DNA sensor involved in innate immune response. POLR3D can sense non-self dsDNA that serves as template for transcription into dsRNA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7646 Product name: Recombinant human POLR3D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 45-398 aa of BC004484 Sequence: SRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTVKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFLDDPGLRNDTRNMPVQLPLAHSGWLFKEENDEPDVKPWLAGPKEEDMEVDIPAVKVKEEPRDEEEEAKMKAPPKAARKTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR Predict reactive species\nFull Name: polymerase (RNA) III (DNA directed) polypeptide D, 44kDa\nCalculated Molecular Weight: 44 kDa\nObserved Molecular Weight: 44 kDa\nGenBank Accession Number: BC004484\nGene Symbol: POLR3D\nGene ID (NCBI): 661\nRRID: AB_2935348\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P05423\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888311980201,"sku":"68263-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68263-1-ig","provider":"Iright","version":"1.0","type":"link"}