{"product_id":"proteintech-68290-1-ig","title":"Proteintech, 68290-1-Ig, RFC3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RFC3 (68290-1-Ig) by Proteintech is a Monoclonal antibody targeting RFC3 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples\n68290-1-Ig targets RFC3 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HSC-T6 cells,  NIH\/3T3 cells,  HeLa cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRFC3, also known as RFC38, is a 356 amino acid protein, which localizes in the nucleus. Replication factor C (RFC) is a component of the eukaryotic DNA polymerase. In all eukaryotic cell cycles, it is essential for DNA duplication, DNA injury repair, and checkpoint control. RFC consists of five subunits (RFC1-5). The interrelationships between RFC2, RFC3, and the c-MYC oncogene (transcription factor) can induce cell division and proliferation. RFC3 is associated with liver, breast, esophageal and ovarian cancer, and serves a critical role in cellular proliferation, invasion, and metastasis. RFC3 exists in two isoforms with molecular weights of 34 kDa and 38-40 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28365 Product name: Recombinant human RFC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-356 aa of BC000149 Sequence: MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF Predict reactive species\nFull Name: replication factor C (activator 1) 3, 38kDa\nCalculated Molecular Weight: 40 aa, 6 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC000149\nGene Symbol: RFC3\nGene ID (NCBI): 5983\nRRID: AB_2935370\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P40938\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888318632105,"sku":"68290-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68290-1-ig","provider":"Iright","version":"1.0","type":"link"}