{"product_id":"proteintech-68291-1-ig","title":"Proteintech, 68291-1-Ig, NRCAM Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NRCAM (68291-1-Ig) by Proteintech is a Monoclonal antibody targeting NRCAM in WB, IF-P, ELISA applications with reactivity to Human, Mouse, Rat, Pig samples\n68291-1-Ig targets NRCAM in WB, IF-P, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, pig brain tissue,  rat cerebellum tissue,  mouse brain tissue,  pig cerebellum tissue\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuronal cell adhesion molecule (NRCAM) is a member of the L1 subfamily of cell adhesion molecules (CAMs) that belong to the immunoglobulin superfamily (PMID: 11329126). NRCAM is a transmembrane protein composed of six Ig-like domains and five fibronectin type-III repeats in the extracellular region, with a highly conserved cytoplasmic tail. It is mainly expressed in the nervous system and is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM is also expressed outside the nervous system. Altered expression of NRCAM has been associated with tumor progression in diverse organs (PMID: 22182708).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat, Pig\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag20558 Product name: Recombinant human NRCAM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 446-628 aa of BC098401 Sequence: EPPRILTPANTLYQVIANRPALLDCAFFGSPLPTIEWFKGAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDATWIVKQPEYAVVQRGSMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDHLVVADVSDDDSGTYTCVANTTLDSVSASAVLSVV Predict reactive species\nFull Name: neuronal cell adhesion molecule\nCalculated Molecular Weight: 1304 aa, 144 kDa\nObserved Molecular Weight: 130-140 kDa\nGenBank Accession Number: BC098401\nGene Symbol: NRCAM\nGene ID (NCBI): 4897\nRRID: AB_2935371\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q92823\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888306770089,"sku":"68291-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68291-1-ig","provider":"Iright","version":"1.0","type":"link"}