{"product_id":"proteintech-68320-1-ig","title":"Proteintech, 68320-1-Ig, Collagen Type III Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Collagen Type III (68320-1-Ig) by Proteintech is a Monoclonal antibody targeting Collagen Type III in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n68320-1-Ig targets Collagen Type III in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig colon tissue, human placenta tissue,  human rectum tissue,  rabbit large intestine tissue,  rat colon tissue\nPositive IHC detected in: human ovary tumor tissue, human hepatocirrhosis tissue,  human placenta tissue,  mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human colon cancer tissue\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nType III collagen is a fibrillar-forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome type IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4229 Product name: Recombinant human COL3A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1150-1466 aa of BC028178 Sequence: DGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL Predict reactive species\nFull Name: collagen, type III, alpha 1\nCalculated Molecular Weight: 1466 aa, 139 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC028178\nGene Symbol: COL3A1\nGene ID (NCBI): 1281\nRRID: AB_2935393\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P02461\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887986397353,"sku":"68320-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68320-1-ig","provider":"Iright","version":"1.0","type":"link"}