{"product_id":"proteintech-68349-1-ig","title":"Proteintech, 68349-1-Ig, AP2B1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe AP2B1 (68349-1-Ig) by Proteintech is a Monoclonal antibody targeting AP2B1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, Mouse, Rat, Rabbit, Pig samples\n68349-1-Ig targets AP2B1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit, Pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig cerebellum tissue, HeLa cells,  rabbit cerebellum tissue,  rat cerebellum tissue,  mouse cerebellum tissue\nPositive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAP2B1 is a component of the adaptor protein complex 2 (AP-2). AP complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in the cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 works on the plasma membrane to internalize cargo in clathrin-mediated endocytosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat, Rabbit, Pig\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8264 Product name: Recombinant human AP2B1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 598-951 aa of BC006201 Sequence: GSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN Predict reactive species\nFull Name: adaptor-related protein complex 2, beta 1 subunit\nCalculated Molecular Weight: 105 kDa\nObserved Molecular Weight: 100-115 kDa\nGenBank Accession Number: BC006201\nGene Symbol: AP2B1\nGene ID (NCBI): 163\nRRID: AB_3085072\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P63010\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888099119273,"sku":"68349-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68349-1-ig","provider":"Iright","version":"1.0","type":"link"}