{"product_id":"proteintech-68360-1-ig","title":"Proteintech, 68360-1-Ig, MCTS1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MCTS1 (68360-1-Ig) by Proteintech is a Monoclonal antibody targeting MCTS1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n68360-1-Ig targets MCTS1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, HeLa cells,  Raji cells,  Jurkat cells,  K-562 cells,  MOLT-4 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMCTS1 is an anti-oncogene that plays a role in cell cycle regulation. It can reduce cell doubling time and anchor-dependent growth. The G1 transition time and the duration of the G1 \/ S transition are shortened. It can also promote the release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (PMID: 10440924).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7057 Product name: Recombinant human MCTS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-181 aa of BC001013 Sequence: MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK Predict reactive species\nFull Name: malignant T cell amplified sequence 1\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC001013\nGene Symbol: MCTS1\nGene ID (NCBI): 28985\nRRID: AB_3085082\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9ULC4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888291795113,"sku":"68360-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68360-1-ig","provider":"Iright","version":"1.0","type":"link"}