{"product_id":"proteintech-68375-1-ig","title":"Proteintech, 68375-1-Ig, DICER1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DICER1 (68375-1-Ig) by Proteintech is a Monoclonal antibody targeting DICER1 in WB, IF\/ICC, IP, ELISA applications with reactivity to Human, mouse samples\n68375-1-Ig targets DICER1 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, LNCaP cells,  HeLa cells,  HEK-293 cells,  K-562 cells,  Jurkat cells,  Ramos cells,  Sp2\/0 cells\nPositive IP detected in: Jurkat cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDICER1 functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. DICER1 cleaves naturally occurring long dsRNAs and short hairpin pre-microRNAs (miRNA) into fragments of twenty-one to twenty-three nucleotides with 3' overhang of two nucleotides, and producing respectively short interfering RNAs (siRNA) and mature microRNAs. SiRNAs and miRNAs serve as guide to direct the RNA-induced silencing complex (RISC) to complementary RNAs to degrade them or prevent their translation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30368 Product name: Recombinant human DICER1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 432-534 aa of NM_030621 Sequence: TNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLV Predict reactive species\nFull Name: dicer 1, ribonuclease type III\nCalculated Molecular Weight: 219 kDa\nObserved Molecular Weight: 240-250 kDa\nGenBank Accession Number: NM_030621\nGene Symbol: DICER1\nGene ID (NCBI): 23405\nRRID: AB_3085094\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9UPY3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888272298153,"sku":"68375-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68375-1-ig","provider":"Iright","version":"1.0","type":"link"}