{"product_id":"proteintech-68381-1-ig","title":"Proteintech, 68381-1-Ig, UGP2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe UGP2 (68381-1-Ig) by Proteintech is a Monoclonal antibody targeting UGP2 in WB, IHC, ELISA applications with reactivity to Human, mouse, Rat, Pig, Rabbit samples\n68381-1-Ig targets UGP2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, Rat, Pig, Rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, pig liver tissue,  LNCaP cells,  rabbit liver tissue,  rat liver tissue,  mouse liver tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUDP-glucose pyrophosphorylase 2 (UGP2, synonyms: UDPG, UGPP2, UDPGP2, Phc379) is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. So far two isoforms are encoded by two transcript variants have been found.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, Rat, Pig, Rabbit\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag33160 Product name: Recombinant human UGP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-288 aa of BC002954 Sequence: SQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYE Predict reactive species\nFull Name: UDP-glucose pyrophosphorylase 2\nCalculated Molecular Weight: 56 kDa\nObserved Molecular Weight: 50-56 kDa\nGenBank Accession Number: BC002954\nGene Symbol: UGP2\nGene ID (NCBI): 7360\nRRID: AB_3085099\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q16851\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888334983337,"sku":"68381-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68381-1-ig","provider":"Iright","version":"1.0","type":"link"}