{"product_id":"proteintech-68384-1-ig","title":"Proteintech, 68384-1-Ig, FOXC2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FOXC2 (68384-1-Ig) by Proteintech is a Monoclonal antibody targeting FOXC2 in WB, IHC, ELISA applications with reactivity to Human, Rat, Pig samples\n68384-1-Ig targets FOXC2 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Rat, Pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: hTERT-RPE1 cells, U-87 MG cells,  rat kidney tissue,  rat heart tissue,  rat adipose tissue,  pig adipose tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nForkhead box protein C2 (FOXC2) also known as forkhead-related protein FKHL14 (FKHL14), transcription factor FKH-14, or mesenchyme fork head protein 1 (MFH1) is a protein that in humans is encoded by the FOXC2 gene. FOXC2 is a member of the fork head box (FOX) family of transcription factors. FOX transcription factors are expressed during development and are associated with a number of cellular and developmental differentiation processes. FOXC2 is required during early development of the kidneys, including differentiation of podocytes and maturation of the glomerular basement membrane. It is also involved in the early development of the heart. FOXC2 is also involved in cancer metastases. In particular, expression of FOXC2 is induced when epithelial cells undergo an epithelial-mesenchymal transition (EMT) and become mesenchymal looking cells. (PMID: 8674414 9169153 19935708)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Rat, Pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19378 Product name: Recombinant human FOXC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 205-501 aa of BC113437 Sequence: KEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCVPPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQAASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY Predict reactive species\nFull Name: forkhead box C2 (MFH-1, mesenchyme forkhead 1)\nCalculated Molecular Weight: 501 aa, 54 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC113437\nGene Symbol: FOXC2\nGene ID (NCBI): 2303\nRRID: AB_3085102\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q99958\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888062681257,"sku":"68384-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68384-1-ig","provider":"Iright","version":"1.0","type":"link"}