{"product_id":"proteintech-68388-1-ig","title":"Proteintech, 68388-1-Ig, ANKRD54 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANKRD54 (68388-1-Ig) by Proteintech is a Monoclonal antibody targeting ANKRD54 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples\n68388-1-Ig targets ANKRD54 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, U2OS cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAnkyrin repeat domain 54 (ANKRD54)\/Liar is a nuclear-cytoplasmic shuttling\nadaptor that interacts with Lyn, Btk, Txk, and HCLS1. Activation of PKC kinases promoted nuclear export and phosphorylation of Ankrd54, and increased interaction and cytoplasmic co-localization with Lyn.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag22772 Product name: Recombinant human ANKRD54 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 201-300 aa of BC066909 Sequence: RVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR Predict reactive species\nFull Name: ankyrin repeat domain 54\nCalculated Molecular Weight: 300 aa, 33 kDa\nObserved Molecular Weight: 33-35 kDa\nGenBank Accession Number: BC066909\nGene Symbol: ANKRD54\nGene ID (NCBI): 129138\nRRID: AB_3085106\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q6NXT1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888087224489,"sku":"68388-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68388-1-ig","provider":"Iright","version":"1.0","type":"link"}