{"product_id":"proteintech-68391-1-ig","title":"Proteintech, 68391-1-Ig, HDDC2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HDDC2 (68391-1-Ig) by Proteintech is a Monoclonal antibody targeting HDDC2 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n68391-1-Ig targets HDDC2 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  MCF-7 cells\nPositive IHC detected in: mouse kidney tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Saos-2 cells\nPositive FC (Intra) detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHDDC2, also named as C6orf74, plays a role in the maintenance of pluripotency in human ES and iPS cells. HDDC2 is a nuclear‐encoded but mitochondrially localized protein. It has been reported as associated with oxidative metabolism.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag33258 Product name: Recombinant human HDDC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 15-218 aa of BC003357 Sequence: MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETQSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS Predict reactive species\nFull Name: HD domain containing 2\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC003357\nGene Symbol: HDDC2\nGene ID (NCBI): 51020\nRRID: AB_3085109\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q7Z4H3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888282521769,"sku":"68391-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68391-1-ig","provider":"Iright","version":"1.0","type":"link"}