{"product_id":"proteintech-68405-1-ig","title":"Proteintech, 68405-1-Ig, GATC Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GATC (68405-1-Ig) by Proteintech is a Monoclonal antibody targeting GATC in WB, IF\/ICC, ELISA applications with reactivity to human samples\n68405-1-Ig targets GATC in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, A549 cells,  HEK-293 cells,  K-562 cells\nPositive IF\/ICC detected in: HEK-293 cells\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGATC encodes a subunit of the glutamyl-tRNA(Gln) amidotransferase protein complex (GatCAB), which plays a role in aminoacylation of mitochondrial glutaminyl mt-tRNA. The complex plays an role in mitochondrial translation and protein synthesis (PubMed: 30283131).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19857 Product name: Recombinant human GATC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-136 aa of BC107145 Sequence: MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS Predict reactive species\nFull Name: glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial)\nCalculated Molecular Weight: 136 aa, 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC107145\nGene Symbol: GATC\nGene ID (NCBI): 283459\nRRID: AB_3085122\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O43716\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888279081129,"sku":"68405-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68405-1-ig","provider":"Iright","version":"1.0","type":"link"}