{"product_id":"proteintech-68419-1-ig","title":"Proteintech, 68419-1-Ig, Hexokinase 1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Hexokinase 1 (68419-1-Ig) by Proteintech is a Monoclonal antibody targeting Hexokinase 1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat, pig samples\n68419-1-Ig targets Hexokinase 1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HT-1080 cells,  U-87 MG cells,  SK-BR-3 cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells,  pig brain tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1024-1:4098\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe hexokinases (HKs) catalyze the first obligatory step in glucose metabolism to generate glucose-6-phosphate. This not only furthers glucose entry by maintaining the concentration gradient for facilitated glucose influx but also provides the first intermediate for essentially all major pathways using glucose. There are four conventional HK isoforms, HK1\/2\/3\/4, encoded by four different genes. Most adult tissues express only HK1. Muscle and adipose tissue use HK2 for glycolysis, liver, and pancreatic beta cells express HK4 (also called glucokinase) and do not express HK1 or HK2. (PMID: 31434645, PMID: 31848318)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8015 Product name: Recombinant human HK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 583-917 aa of BC008730 Sequence: SDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS Predict reactive species\nFull Name: hexokinase 1\nCalculated Molecular Weight: 102 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC008730\nGene Symbol: Hexokinase 1\nGene ID (NCBI): 3098\nRRID: AB_3085134\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P19367\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888064319657,"sku":"68419-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68419-1-ig","provider":"Iright","version":"1.0","type":"link"}