{"product_id":"proteintech-68439-1-ig","title":"Proteintech, 68439-1-Ig, ARP3\/ARP3B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARP3\/ARP3B (68439-1-Ig) by Proteintech is a Monoclonal antibody targeting ARP3\/ARP3B in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat, rabbit, pig samples\n68439-1-Ig targets ARP3\/ARP3B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat, rabbit, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Calu-3 cells, A549 cells,  U2OS cells,  HeLa cells,  Human peripheral blood platelets,  Pig lung tissue,  Rabbit lung tissue,  Rat lung tissue,  Mouse lung tissue\nPositive IHC detected in: mouse brain tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARP3 (also known as ACTR3) is a major constituent of the ARP2\/3 complex that is necessary for nucleating actin polymerization at filament branches. ARP3 localizes to the lamellipodia of stationary and locomoting fibroblasts. Overexpression of ARP3 has been reported in several types of cancer cells. This antibody recognizes endogenous ARP3 and may cross-react with ATCR3B.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat, rabbit, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag5017 Product name: Recombinant human ACTR3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 156-418 aa of BC044590 Sequence: RQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS Predict reactive species\nFull Name: ARP3 actin-related protein 3 homolog (yeast)\nCalculated Molecular Weight: 418 aa 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC044590\nGene Symbol: ARP3\/ACTR3\nGene ID (NCBI): 10096\nRRID: AB_3085152\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P61158\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888100167849,"sku":"68439-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68439-1-ig","provider":"Iright","version":"1.0","type":"link"}