{"product_id":"proteintech-68442-1-ig","title":"Proteintech, 68442-1-Ig, ATP6 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP6 (68442-1-Ig) by Proteintech is a Monoclonal antibody targeting ATP6 in WB, ELISA applications with reactivity to Human, Rat samples\n68442-1-Ig targets ATP6 in WB, ELISA applications and shows reactivity with Human, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat cerebellum tissue, Rat heart tissue,  Rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP synthase, also known as FoF1 complex, is a critical mitochondrial OXPHOS enzyme involved in the regulation of mitochondrial ATP production and in the maintenance of the mitochondrial membrane potential. It is composed of three components (F1, Fo and the peripheral stalk).\nF1, the soluble catalytic core, is above the membrane, inside the matrix of the mitochondria; consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon); Fo, comprising the proton channel, is within the membrane; Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). ATP6 is the a subunit of Fo region.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Rat\nCited Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag31940 Product name: Recombinant human ATP6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 26-68 aa of YP_003024031 Sequence: FPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKGRTW Predict reactive species\nFull Name: ATP synthase 6; ATPase subunit 6\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: YP_003024031\nGene Symbol: ATP6\nGene ID (NCBI): 4508\nRRID: AB_3085155\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P00846\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888037023913,"sku":"68442-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68442-1-ig","provider":"Iright","version":"1.0","type":"link"}