{"product_id":"proteintech-68448-1-ig","title":"Proteintech, 68448-1-Ig, Aquaporin 4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Aquaporin 4 (68448-1-Ig) by Proteintech is a Monoclonal antibody targeting Aquaporin 4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n68448-1-Ig targets Aquaporin 4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, rat spinal cord tissue,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAquaporins are specialized water transport channels in plasma membranes of water-permeable tissues. Aquaporin-4 (AQP4) is the most abundant water channel in the human central nervous system and is important to fluid movements in brain. Aquaporin-4 exists as two isoforms, a long (M1) isoform with translation initiation at Met-1, and a shorter (M23) isoform with translation initiation at Met-23, with molecular weights around 35-37 kDa and 32-34 kDa, respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9830 Product name: Recombinant human AQP4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 208-323 aa of BC022286 Sequence: TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV Predict reactive species\nFull Name: Aquaporin 4\nCalculated Molecular Weight: 323 aa, 35 kDa\nObserved Molecular Weight: 35-37 kDa\nGenBank Accession Number: BC022286\nGene Symbol: Aquaporin 4\nGene ID (NCBI): 361\nRRID: AB_3085160\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P55087\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888025096361,"sku":"68448-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68448-1-ig","provider":"Iright","version":"1.0","type":"link"}