{"product_id":"proteintech-68466-1-ig","title":"Proteintech, 68466-1-Ig, SMURF1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMURF1 (68466-1-Ig) by Proteintech is a Monoclonal antibody targeting SMURF1 in WB, ELISA applications with reactivity to human, mouse samples\n68466-1-Ig targets SMURF1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HEK-293 cells,  MCF-7 cells,  A549 cells,  U2OS cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSMURF1, also named as KIAA1625, is E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. SMURF1 interacts with receptor-regulated SMADs specific for the BMP pathway, SMAD1 and SMAD5, in order to trigger their ubiquitination and degradation and hence their inactivation. SMURF1 can be detected as 90-100 kDa when ubiquitinated (PMID:17576816, PMID:20484049).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30891 Product name: Recombinant human SMURF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 150-269 aa of NM_020429 Sequence: VDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPS Predict reactive species\nFull Name: SMAD specific E3 ubiquitin protein ligase 1\nCalculated Molecular Weight: 86 kDa\nObserved Molecular Weight: 86 kDa\nGenBank Accession Number: NM_020429\nGene Symbol: SMURF1\nGene ID (NCBI): 57154\nRRID: AB_3085177\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9HCE7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888325415081,"sku":"68466-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68466-1-ig","provider":"Iright","version":"1.0","type":"link"}