{"product_id":"proteintech-68469-1-ig","title":"Proteintech, 68469-1-Ig, MIRO2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MIRO2 (68469-1-Ig) by Proteintech is a Monoclonal antibody targeting MIRO2 in WB, ELISA applications with reactivity to human samples\n68469-1-Ig targets MIRO2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, A549 cells,  LNCaP cells,  HeLa cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HL-60 cells,  THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRHOT2 (Mitochondrial Rho GTPase 2) is also named as MIRO-2, hMiro-2, ARHT2, C16orf39 and Ras homolog gene family member T2. RHOT2 belongs to the mitochondrial Rho GTPase family. RHOT2 gene encodes a member of Rho family of GTPase, which are localized to the outer membrane of mitochondria (PMID: 22078885).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29690 Product name: Recombinant human RHOT2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 388-548 aa of BC014942 Sequence: LCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRL Predict reactive species\nFull Name: ras homolog gene family, member T2\nCalculated Molecular Weight: 68 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC014942\nGene Symbol: RHOT2\nGene ID (NCBI): 89941\nRRID: AB_3085180\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8IXI1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888293138601,"sku":"68469-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68469-1-ig","provider":"Iright","version":"1.0","type":"link"}