{"product_id":"proteintech-68480-1-ig","title":"Proteintech, 68480-1-Ig, Smac\/DIABLO Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Smac\/DIABLO (68480-1-Ig) by Proteintech is a Monoclonal antibody targeting Smac\/DIABLO in WB, IF\/ICC, ELISA applications with reactivity to human, rat samples\n68480-1-Ig targets Smac\/DIABLO in WB, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, K-562 cells,  LNCaP cells,  HeLa cells,  HEK-293 cells,  Jurkat cells,  HSC-T6 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSmac\/DIABLO is a mitochondrial protein that promotes apoptosis by neutralizing members of the IAP family. SMAC\/DIABLO is ubiquitously expressed in normal tissues, and the expression of SMAC messenger RNA (mRNA) in adult testis is the highest .Smac\/DIABLO encodes a 239 amino acid protein (~27 kDa). The first 55 amino acids are a mitochondrial targeting signal peptide that is cleaved to generate mature Smac-DIABLO (~21 kDa). When released from mitochondria, Smac-DIABLO acts as a natural antagonist of inhibitor of apoptosis proteins (IAPs). Smac-DIABLO antagonistic activity is based on its N-terminal tetrapeptide (AVPI) that binds baculoviral IAP repeat (BIR) domains of IAPs, releasing their inhibitory effects on both initiator and effector caspases, thus promoting cell death. (PMID: 32325691, PMID: 32575872,PMID: 25650938)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag32774 Product name: Recombinant human DIABLO protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-239 aa of BC011909 Sequence: MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED Predict reactive species\nFull Name: diablo homolog (Drosophila)\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC011909\nGene Symbol: DIABLO\nGene ID (NCBI): 56616\nRRID: AB_3085191\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9NR28\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888324858025,"sku":"68480-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68480-1-ig","provider":"Iright","version":"1.0","type":"link"}