{"product_id":"proteintech-68490-1-ig","title":"Proteintech, 68490-1-Ig, ABCF2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABCF2 (68490-1-Ig) by Proteintech is a Monoclonal antibody targeting ABCF2 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n68490-1-Ig targets ABCF2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  MDA-MB-231 cells,  Jurkat cells,  MOLT-4 cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 clls\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nABCF2 (ABC28, M-ABC1, HUSSY-18, EST133090, DKFZp586K1823) is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins are composed of transmembrane domains (TMDs), and nucleotide binding domains (NBDs, or ATP-binding cassettes, ABSs). Based on their sequence similarity scores, the members of the human ABC protein family can be grouped into eight subfamilies, including the MDR\/TAP, the ALD, the MRP\/CFTR, the ABC1, the White, the RNAseL inhibitor, the ANSA, and the GCN20 subfamilies. ABCF2 is a member of the GCN20 subfamily. ABC proteins transport various molecules across extra- and intracellular membranes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag33824 Product name: Recombinant human ABCF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-216 aa of BC001661 Sequence: PSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLG Predict reactive species\nFull Name: ATP-binding cassette, sub-family F (GCN20), member 2\nCalculated Molecular Weight: 71 kDa\nObserved Molecular Weight: 71 kDa\nGenBank Accession Number: BC001661\nGene Symbol: ABCF2\nGene ID (NCBI): 10061\nRRID: AB_3085201\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UG63\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888083816617,"sku":"68490-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68490-1-ig","provider":"Iright","version":"1.0","type":"link"}