{"product_id":"proteintech-68513-1-ig","title":"Proteintech, 68513-1-Ig, GATM Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GATM (68513-1-Ig) by Proteintech is a Monoclonal antibody targeting GATM in WB, ELISA applications with reactivity to human, mouse, rat, pig samples\n68513-1-Ig targets GATM in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig kidney tissue, rat kidney tissue,  mouse kidney tissue,  pig pancreas tissue,  rat pancreas tissue,  mouse pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGATM, also known as AGAT, produces ornithine and guanidinoacetate (GAA) from arginine and glycine, and is a key enzyme for creatine synthesis. GATM deficiency in early infancy causes neurodevelopmental delay. GATM is predominantly expressed in kidney and pancreas in adults. Decrease of GAMT proteins was observed in proximal tubule damage cases, which links GATM as a general marker for proximal tubule damage. Alternative splicing of GATM generates three isoforms with molecular weights between 44 kDa to 48 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3754 Product name: Recombinant human GATM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 74-423 aa of BC004141 Sequence: PLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYLD Predict reactive species\nFull Name: glycine amidinotransferase (L-arginine:glycine amidinotransferase)\nCalculated Molecular Weight: 423 aa, 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC004141\nGene Symbol: GATM\nGene ID (NCBI): 2628\nRRID: AB_3085222\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P50440\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887980138665,"sku":"68513-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68513-1-ig","provider":"Iright","version":"1.0","type":"link"}