{"product_id":"proteintech-68522-1-ig","title":"Proteintech, 68522-1-Ig, STK24 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe STK24 (68522-1-Ig) by Proteintech is a Monoclonal antibody targeting STK24 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n68522-1-Ig targets STK24 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, LNCaP cells,  HeLa cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IF-P detected in: rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSerine\/threonine-protein kinase 24 (STK24), also named MST3, belonging to GCK subfamily of STE20-like kinases, acts on both serine and threonine residues and promotes apoptosis in response to stress stimuli and caspase activation (PubMed: 10644707, PMID:12107159). STK24 and STK25 operate in the same cardiovascular development pathway with programmed cell death 10 (CCM3) (PMID: 20332113). It regulates axon outgrowth in forebrain neurons (PubMed: 17114295).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag31526 Product name: Recombinant human STK24 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 320-443 aa of NM_003576 Sequence: SDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH Predict reactive species\nFull Name: serine\/threonine kinase 24 (STE20 homolog, yeast)\nCalculated Molecular Weight: 49KD\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: NM_003576\nGene Symbol: STK24\nGene ID (NCBI): 8428\nRRID: AB_3085231\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9Y6E0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888327872681,"sku":"68522-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68522-1-ig","provider":"Iright","version":"1.0","type":"link"}