{"product_id":"proteintech-68542-1-ig","title":"Proteintech, 68542-1-Ig, MYB\/c-Myb Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYB\/c-Myb (68542-1-Ig) by Proteintech is a Monoclonal antibody targeting MYB\/c-Myb in WB, FC (Intra), ELISA applications with reactivity to human samples\n68542-1-Ig targets MYB\/c-Myb in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, MOLT-4 cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe MYB protein is a transcription factor that plays a key role in regulating the proliferation\/differentiation of progenitor cells in bone marrow, colonic crypts, and neurogenic niches [PMID:18574464]. It is involved in the regulation of epithelial-to-mesenchymal transition (EMT) and invasion in neuroblastoma, colon carcinoma, and embryonic kidney cells through the upregulation of the transcription repressor Slug [PMID:20622260]. It also a DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3', and plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells. MYB exists some isoforms with MV 85, 75, 72, 68, 63 and 40 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag12021 Product name: Recombinant human MYB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-356 aa of BC064955 Sequence: MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPS Predict reactive species\nFull Name: v-myb myeloblastosis viral oncogene homolog (avian)\nCalculated Molecular Weight: 640 aa, 72 kDa\nObserved Molecular Weight: 40-50 kDa, 72-80 kDa\nGenBank Accession Number: BC064955\nGene Symbol: c-Myb\nGene ID (NCBI): 4602\nRRID: AB_3085249\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P10242\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888300740777,"sku":"68542-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68542-1-ig","provider":"Iright","version":"1.0","type":"link"}