{"product_id":"proteintech-68551-1-ig","title":"Proteintech, 68551-1-Ig, FMNL2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FMNL2 (68551-1-Ig) by Proteintech is a Monoclonal antibody targeting FMNL2 in WB, ELISA applications with reactivity to Human samples\n68551-1-Ig targets FMNL2 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, hTERT-RPE1 cells,  HEK-293 cells,  A549 cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFormin-like 2 (FMNL2), also known as FRL3 or FHOD2, a member of the diaphanous-related formins, contains a GTPase-binding domain and autoregulatory domains, and is proposed to function as a downstream effector of Rho family guanosine triphosphatases (GTPases) (PMID:15950879). FMNL2 mRNA is expressed in many normal tissues and dysregulated in several cancers such as colorectal cancer, melanoma and involved in invasive behaviours and progression of cancer cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag34164 Product name: Recombinant human FMNL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 400-520 aa of BC167159 Sequence: ENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGPTMGA Predict reactive species\nFull Name: formin-like 2\nObserved Molecular Weight: 140-150 kDa\nGenBank Accession Number: BC167159\nGene Symbol: FMNL2\nGene ID (NCBI): 114793\nRRID: AB_3085255\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96PY5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888277508265,"sku":"68551-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68551-1-ig","provider":"Iright","version":"1.0","type":"link"}