{"product_id":"proteintech-68554-1-ig","title":"Proteintech, 68554-1-Ig, STARD10 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe STARD10 (68554-1-Ig) by Proteintech is a Monoclonal antibody targeting STARD10 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n68554-1-Ig targets STARD10 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SK-BR-3 cells, MCF-7 cells,  T-47D cells,  LNCaP cells,  rat liver tissue,  mouse liver tissue,  pig liver tissue,  rabbit liver tissue,  rabbit testis tissue\nPositive IP detected in: HepG2 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTARD10 (START domain-containing protein 10, also known as PCTP-like protein) is highly expressed in liver and responsible to transfer phosphatidylcholine. STARD10 was identified as a protein overexpressed in breast cancer that cooperates with the ErbB family of receptor tyrosine kinases in cellular transformation (PMID: 15911624). This antibody detected duplicate bands between 35-40 kDa (PMID: 15150109).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag10932 Product name: Recombinant human STARD10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-291 aa of BC007919 Sequence: MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT Predict reactive species\nFull Name: StAR-related lipid transfer (START) domain containing 10\nCalculated Molecular Weight: 291 aa, 33 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC007919\nGene Symbol: STARD10\nGene ID (NCBI): 10809\nRRID: AB_3085257\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9Y365\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888327512233,"sku":"68554-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68554-1-ig","provider":"Iright","version":"1.0","type":"link"}