{"product_id":"proteintech-68557-5-ig","title":"Proteintech, 68557-5-Ig, TFAM Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TFAM (68557-5-Ig) by Proteintech is a Monoclonal antibody targeting TFAM in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n68557-5-Ig targets TFAM in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, Caco-2 cells,  HEK-293 cells,  U2OS cells,  LNCaP cells,  MOLT-4 cells,  MJ cells,  K-562 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTFAM, also named as TCF6L2, MtTF1, TCF6, TCF6L1, TCF6L3, and mtTFA, is a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. It is involved in mitochondrial transcription regulation. TFAM is required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. It activates transcription by binding immediately upstream of transcriptional start sites. TFAM is able to unwind and bend DNA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18253 Product name: Recombinant human TFAM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-246 aa of BC126366 Sequence: MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC Predict reactive species\nFull Name: transcription factor A, mitochondrial\nCalculated Molecular Weight: 246 aa, 29 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC126366\nGene Symbol: TFAM\nGene ID (NCBI): 7019\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q00059\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888330231977,"sku":"68557-5-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68557-5-ig","provider":"Iright","version":"1.0","type":"link"}