{"product_id":"proteintech-68588-1-ig","title":"Proteintech, 68588-1-Ig, IQGAP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IQGAP1 (68588-1-Ig) by Proteintech is a Monoclonal antibody targeting IQGAP1 in WB, IHC, ELISA applications with reactivity to human, rat samples\n68588-1-Ig targets IQGAP1 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, A549 cells,  LNCaP cells,  MCF-7 cells,  HeLa cells,  HepG2 cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIQGAP1 is a member of a family of scaffolding proteins that interact with signaling and structural molecules. It localizes to sites of cell-cell contact in epithelial cells and regulates distinct cellular processes including cell adhesion, cell migration, extracellular signals through interacting with numerous protein. Multiple studies have shown that IQGAP1 is up-regulated in many human malignancies, such as lung cancer, ovarian cancer, colon cancer, breast cancer, melanoma and HCC. And IQGAP1 plays a critical role in cancer cell invasion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19321 Product name: Recombinant human IQGAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 478-827 aa of BC151834 Sequence: QLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRD Predict reactive species\nFull Name: IQ motif containing GTPase activating protein 1\nCalculated Molecular Weight: 189 kDa\nObserved Molecular Weight: 190-195 kDa\nGenBank Accession Number: BC151834\nGene Symbol: IQGAP1\nGene ID (NCBI): 8826\nENSEMBL Gene ID: ENSG00000140575\nRRID: AB_3085287\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P46940\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888287633577,"sku":"68588-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68588-1-ig","provider":"Iright","version":"1.0","type":"link"}