{"product_id":"proteintech-68591-1-ig","title":"Proteintech, 68591-1-Ig, RAG1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAG1 (68591-1-Ig) by Proteintech is a Monoclonal antibody targeting RAG1 in WB, ELISA applications with reactivity to Human, mouse samples\n68591-1-Ig targets RAG1 in WB, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRecombination-activating gene (RAG) proteins include RAG1 and RAG2, which are crucial for Ig and T lymphocyte receptor (TCR) fragment rearrangement and are responsible for DNA recognition and cleavage at specific sequences. Mutations in RAG1 result in the complete or partial loss of recombinant enzyme activity, in unbalanced variable-diversity-joining (V(D)J) recombination, and in the impairment of T and B lymphocyte development at the early stages.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30192 Product name: Recombinant human RAG1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 878-1043 aa of NM_000448 Sequence: RHEALRELMDLYLKMKPVWRSSCPAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYTSKYLQKFMNAHNALKTSGFTMNPQASLGDPLGIEDSLESQDSMEF Predict reactive species\nFull Name: recombination activating gene 1\nCalculated Molecular Weight: 119 kDa\nObserved Molecular Weight: 110-120 kDa\nGenBank Accession Number: NM_000448\nGene Symbol: RAG1\nGene ID (NCBI): 5896\nRRID: AB_3085290\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P15918\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888073068713,"sku":"68591-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68591-1-ig","provider":"Iright","version":"1.0","type":"link"}