{"product_id":"proteintech-68622-1-ig","title":"Proteintech, 68622-1-Ig, UCK2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe UCK2 (68622-1-Ig) by Proteintech is a Monoclonal antibody targeting UCK2 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n68622-1-Ig targets UCK2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, LNCaP cells,  MCF-7 cells,  HeLa cells,  HepG2 cells,  K-562 cells,  HSC-T6 cells,  4T1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUridine-cytidine kinase 2 catalyzes the phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP), respectively. This is the first step in the production of the pyrimidine nucleoside triphosphates required for RNA and DNA synthesis. UCK2 belongs to the uridine kinase family and UCK have important roles for the phosphorylation of nucleoside analogs that may be important in chemotherapy of cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0782 Product name: Recombinant human UCK2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-261 aa of BC002906 Sequence: MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH Predict reactive species\nFull Name: uridine-cytidine kinase 2\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: ~30 kDa\nGenBank Accession Number: BC002906\nGene Symbol: UCK2\nGene ID (NCBI): 7371\nRRID: AB_3085314\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BZX2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888334852265,"sku":"68622-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68622-1-ig","provider":"Iright","version":"1.0","type":"link"}