{"product_id":"proteintech-68647-1-ig","title":"Proteintech, 68647-1-Ig, SHCBP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SHCBP1 (68647-1-Ig) by Proteintech is a Monoclonal antibody targeting SHCBP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n68647-1-Ig targets SHCBP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, U2OS cells,  HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSHCBP1 was initially identified as a potential gene associated with cell proliferation in fibroblasts. SHCBP1 exerts a crucial physiological function in normal tissue development. Chen et al. showed that SHCBP1 is an essential component of FGF signaling in neural progenitor cells. SHCBP1 is also upregulated during T cell proliferation and regulates CD4+ T cell effector function in vivo. Recently, SHCBP1 was shown to be closely associated with cancer development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17517 Product name: Recombinant human SHCBP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 374-672 aa of BC030699 Sequence: NACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEKRGKGDTFVDCTGADIKISGIKFVQHDAVEGILIVHRGKTTLENCVLQCETTGVTVRTSAEFLMKNSDLYGAKGAGIEIYPGSQCTLSDNGIHHCKEGILIKDFLDEHYDIPKISMVNNIIHNNEGYGVVLVKPTIFSDLQESAEDGTEENKALKIQTSGEPDVAERVDLEELIECATGKMELCARTDPSEQVEGNCEIVNELIAASTQKGQIKKKRLSELGITQADDNLMSQEMFVGIVGNQFKWNGKGSFGTFLF Predict reactive species\nFull Name: SHC SH2-domain binding protein 1\nCalculated Molecular Weight: 672 aa, 76 kDa\nObserved Molecular Weight: 76 kDa\nGenBank Accession Number: BC030699\nGene Symbol: SHCBP1\nGene ID (NCBI): 79801\nRRID: AB_3670390\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8NEM2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888323711145,"sku":"68647-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68647-1-ig","provider":"Iright","version":"1.0","type":"link"}