{"product_id":"proteintech-68713-1-ig","title":"Proteintech, 68713-1-Ig, MTF2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTF2 (68713-1-Ig) by Proteintech is a Monoclonal antibody targeting MTF2 in WB, ELISA applications with reactivity to Human, Rat, Rabbit, Mouse samples\n68713-1-Ig targets MTF2 in WB, ELISA applications and shows reactivity with Human, Rat, Rabbit, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  Rabbit testis tissue,  Mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMTF2, also named as Metal-response element-binding transcription factor 2, is a 593 amino acid protein. It exists several isoforms and the range of the molecular weight of isoforms are about 55-60 kDa and 29 kDa. MTF2 contains 2 PHD-type zinc fingers and belongs to the Polycomblike family. MTF2 acts by binding to H3K36me3, a mark for transcriptional activation, and recruiting the PRC2 complex, leading to enhance PRC2 H3K27me3 methylation activity and regulates the transcriptional networks during embryonic stem cell self-renewal and differentiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Rat, Rabbit, Mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9384 Product name: Recombinant human MTF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 187-536 aa of BC010013 Sequence: ADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMEVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS Predict reactive species\nFull Name: metal response element binding transcription factor 2\nCalculated Molecular Weight: 536 aa, 61 kDa\nObserved Molecular Weight: 55 kDa, 60 kDa, 75 kDa\nGenBank Accession Number: BC010013\nGene Symbol: MTF2\nGene ID (NCBI): 22823\nRRID: AB_3670406\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y483\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888295268521,"sku":"68713-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68713-1-ig","provider":"Iright","version":"1.0","type":"link"}