{"product_id":"proteintech-68721-1-ig","title":"Proteintech, 68721-1-Ig, LDB1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe LDB1 (68721-1-Ig) by Proteintech is a Monoclonal antibody targeting LDB1 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n68721-1-Ig targets LDB1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HSC-T6 cells,  NIH\/3T3 cells,  HeLa cells,  HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLIM domain-binding protein 1 (LDB1), also known as Carboxyl-terminal LIM domain-binding protein 2 (CLIM2), binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. LDB1 may regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. It plays a role in the development of interneurons and motor neurons in cooperation with LHX3 and ISL1. LDB1 acts synergistically with LHX1\/LIM1 in axis formation and activation of gene expression. It also acts with LMO2 in the regulation of red blood cell development, maintaining erythroid precursors in an immature state. LDB1 strongly interacts with the LIM2 domain of LMX1A to form homodimer. LDB1 protein is expressed in a wide range of adult tissues including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag34563 Product name: Recombinant human LDB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-211 aa of BC000482 Sequence: MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMFTQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVI Predict reactive species\nFull Name: LIM domain binding 1\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC000482\nGene Symbol: LDB1\nGene ID (NCBI): 8861\nRRID: AB_3670413\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q86U70\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888289927337,"sku":"68721-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68721-1-ig","provider":"Iright","version":"1.0","type":"link"}