{"product_id":"proteintech-68722-2-ig","title":"Proteintech, 68722-2-Ig, EMC7\/C15orf24 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe EMC7\/C15orf24 (68722-2-Ig) by Proteintech is a Monoclonal antibody targeting EMC7\/C15orf24 in WB, ELISA applications with reactivity to Human, Mouse , Rat samples\n68722-2-Ig targets EMC7\/C15orf24 in WB, ELISA applications and shows reactivity with Human, Mouse , Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HSC-T6 cells, LNCaP cells,  MCF-7 cells,  HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  U2OS cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe mammalian ER membrane complex (EMC) is composed of 10 subunits, EMC 1-10. Endoplasmic reticulum membrane protein complex subunit 7(EMC7, also named C15orf24) is part of the endoplasmic reticulum membrane protein complex (EMC) that enables theenergy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse , Rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26813 Product name: Recombinant human C15orf24 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-159 aa of BC104934 Sequence: SEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD Predict reactive species\nFull Name: chromosome 15 open reading frame 24\nObserved Molecular Weight: 20-26 kDa\nGenBank Accession Number: BC104934\nGene Symbol: EMC7\nGene ID (NCBI): 56851\nRRID: AB_3670415\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NPA0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888274624681,"sku":"68722-2-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68722-2-ig","provider":"Iright","version":"1.0","type":"link"}