{"product_id":"proteintech-68873-5-ig","title":"Proteintech, 68873-5-Ig, PANX1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PANX1 (68873-5-Ig) by Proteintech is a Monoclonal antibody targeting PANX1 in WB, ELISA applications with reactivity to human, mouse samples\n68873-5-Ig targets PANX1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SCaBER cells, MDA-MB-231 cells,  HaCaT cells,  SH-SY5Y cells,  Jurkat cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPANX1, also named as MRS1, belongs to the pannexin family. It plays a role as a Ca2+-leak channel to regulate ER Ca2+ homeostasis. It is a structural component of the gap junctions and the hemichannels. PANX1 induced the formation of intercellular channels with characteristics of gap junctions. PANX1 is 48-kDa protein which contains 4 transmembrane domains and cytoplasmic N and C termini. It is a mediator of find-me signal\/nucleotide release from apoptotic cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag33689 Product name: Recombinant human PANX1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 126-426 aa of BC016931 Sequence: FWRFAAAPHICSDLKFIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLGQSLWEVSESHFKYPIVEQYLKTKKNSNNLIIKYISCRLLTLIIILLACIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINLVVYVLLAPVVVYTLFVPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC Predict reactive species\nFull Name: pannexin 1\nCalculated Molecular Weight: 426 aa, 48 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC016931\nGene Symbol: PANX1\nGene ID (NCBI): 24145\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96RD7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888308441257,"sku":"68873-5-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68873-5-ig","provider":"Iright","version":"1.0","type":"link"}