{"product_id":"proteintech-68981-3-ig","title":"Proteintech, 68981-3-Ig, LAPTM4B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe LAPTM4B (68981-3-Ig) by Proteintech is a Monoclonal antibody targeting LAPTM4B in WB, ELISA applications with reactivity to human samples\n68981-3-Ig targets LAPTM4B in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: TT cells, K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLAPTM4B, a novel oncoprotein, is associated with the prognosis of cancer, and may play important roles in the initiation, promotion and metastasis of tumors. It was initially identified as a hepatocellular carcinoma-associated gene, and was recently shown to be up-regulated in various human cancers. Some studies indicated that LAPTM4B may be an useful marker of prognosis in ovarian carcinoma and endometrial cancer. LAPTM4B belongs to the LAPTM4\/LAPTM5 transporter family. It has 3 isoforms with molecular masses 41 kDa, 35 kDa and 24 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag38696 Product name: Recombinant human LAPTM4B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-139 aa of BC014129 Sequence: MKMVAPWTRFYSNSCCLCCHVRTGTILLGVWYLIINAVVLLILLSALADPDQYNFSSSELGGDFEFMDDANMCIAIAISLLMILICAMATYGAYKQRAAWIIPFFCYQIFDFALNMLVAITVLIYPNSIQEYIRQLPPN Predict reactive species\nFull Name: lysosomal protein transmembrane 4 beta\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC014129\nGene Symbol: LAPTM4B\nGene ID (NCBI): 55353\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q86VI4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888289665193,"sku":"68981-3-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68981-3-ig","provider":"Iright","version":"1.0","type":"link"}