{"product_id":"proteintech-80002-1-rr","title":"Proteintech, 80002-1-RR, TDP-43 (N-terminal) Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TDP-43 (N-terminal) (80002-1-RR) by Proteintech is a Recombinant antibody targeting TDP-43 (N-terminal) in WB, IHC, IHC-Autostainer, IF\/ICC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n80002-1-RR targets TDP-43 (N-terminal) in WB, IHC, IHC-Autostainer, IF\/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HAP1 cells,  K-562 cells,  Neuro-2a cells,  C6 cells\nPositive IP detected in: HAP1 cells, HeLa cells\nPositive IHC-Autostainer detected in: human brain tissue\nPositive IHC detected in: mouse brain tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat brain tissue\nPositive IF\/ICC detected in: HeLa cells, HepG2 cells,  SH-SY5Y cells,  HAP1 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC)-AUTOSTAINER: IHC-AUTOSTAINER : 1:50-1:500\nImmunohistochemistry (IHC): IHC : 1:1600-1:6400\nImmunofluorescence (IF)-P: IF-P : 1:800-1:3200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe TARDBP gene encodes the TDP-43 protein, initially found to repress HIV-1 transcription by binding TAR DNA. TDP-43 has since been shown to bind RNA as well as DNA, and have multiple functions in transcriptional repression, translational regulation and pre-mRNA splicing. For instance, it is reported to regulate alternate splicing of the CTFR gene.\nIn 2006 Neumann et al. found that hyperphosphorylated, ubiquitinated and\/or cleaved forms of TDP-43, collectively known as pathological TDP-43, play a major role in the disease mechanisms of ubiquitin-positive, tau- and alpha-synuclein-negative frontotemporal dementia (FTLD-U) and in amyotrophic lateral sclerosis (ALS).\nProteintech's 80002-1-RR is a rabbit recombinant TDP-43 antibody recognizing N-terminal TDP-43. It recognizes the intact 43 kDa protein as well as all posttranslationally modified and truncated forms in multiple applications. Various forms of TDP-43 exist, including 18-35 kDa of cleaved C-terminal fragments, 45-50 kDa phospho-protein, 55 kDa glycosylated form, 75 kDa hyperphosphorylated form, and 90-300 kDa cross-linked form. (PMID: 17023659, 19823856, 21666678, 22193176)\nRecently TDP-43 has been reported to be overexpressed in triple negative breast cancer (TNBC) and it may be a potential target for TNBC diagnosis and drug design. (PMID: 29581274)80002-1-RR antibody works well in IF experiment.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1231 Product name: Recombinant human TDP-43 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-260 aa of BC001487 Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA Predict reactive species\nFull Name: TAR DNA binding protein\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC001487\nGene Symbol: TDP-43\nGene ID (NCBI): 23435\nRRID: AB_2882934\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13148\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888342716585,"sku":"80002-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-80002-1-rr","provider":"Iright","version":"1.0","type":"link"}