{"product_id":"proteintech-80046-5-rr","title":"Proteintech, 80046-5-RR, HSP27 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HSP27 (80046-5-RR) by Proteintech is a Recombinant antibody targeting HSP27 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n80046-5-RR targets HSP27 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  A549 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHSPB1, also known as heat shock protein 27 (HSP27), belongs to the small heat shock protein family which is induced in response to environmental challenges or\/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (PMID: 21353161). It's notable that mouse HSP27 is also named HSP25 and has the predicted MW between 19-23 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4620 Product name: Recombinant Human HSP27 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 70-184 aa of NM_001540.5 Sequence: APAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVT Predict reactive species\nFull Name: heat shock 27kDa protein 1\nCalculated Molecular Weight: 23kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: NM_001540.5\nGene Symbol: HSPB1\nGene ID (NCBI): 3315\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P04792\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888763916457,"sku":"80046-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-80046-5-rr","provider":"Iright","version":"1.0","type":"link"}