{"product_id":"proteintech-80152-1-rr","title":"Proteintech, 80152-1-RR, TMPRSS2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TMPRSS2 (80152-1-RR) by Proteintech is a Recombinant antibody targeting TMPRSS2 in WB, ELISA applications with reactivity to Human samples\n80152-1-RR targets TMPRSS2 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, LNCaP cells,  Caco-2 cells,  COLO 320 cells,  HT-29 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMPRSS2, also named as PRSS10, is a type II transmembrane serine protease which is highly expressed by the epithelium of the human prostate gland. TMPRSS2 may contribute to prostate tumor metastasis via the activation of PAR-2. TMPRSS2 is a Serine protease that proteolytically cleaves and activates the viral spike glycoproteins which facilitate virus-cell membrane fusions. TMPRSS2 as a host cell factor that is critical for spread of several clinically relevant viruses, including influenza A viruses and coronaviruses (PMID: 23468491, 30626688). SARS-CoV-2 uses the SARS-CoV receptor ACE2 for entry and the serine protease TMPRSS2 for S protein priming. The initial spike protein priming by TMPRSS2 is essential for entry and viral spread of SARS-CoV-2 through interaction with the ACE2 receptor (PMID: 32142651, 30626688 ). Camostat mesylate, an inhibitor of TMPRSS2, can block SARS-CoV-2 infection of lung cells (PMID: 32142651). The MW of TMPRSS2 is about 65-70 kDa. It can be cleaved into some chains with MW 54 kDa, 31 kDa and 26 kDa (PMID: 25734995, 20382709, 26018085).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5824 Product name: Recombinant human TMPRSS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 108-492 aa of BC051839 Sequence: FMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG Predict reactive species\nFull Name: transmembrane protease, serine 2\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC051839\nGene Symbol: TMPRSS2\nGene ID (NCBI): 7113\nRRID: AB_2935544\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O15393\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888670331049,"sku":"80152-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-80152-1-rr","provider":"Iright","version":"1.0","type":"link"}