{"product_id":"proteintech-80313-1-rr","title":"Proteintech, 80313-1-RR, BCL2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe BCL2 (80313-1-RR) by Proteintech is a Recombinant antibody targeting BCL2 in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n80313-1-RR targets BCL2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, Raji cells,  THP-1 cells,  HL-60 cells,  U-937 cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue, human appendicitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:2500-1:10000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBCL2 belongs to the Bcl-2 family. It suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. BCL2 regulates cell death by controlling the mitochondrial membrane permeability (PMID: 10365962). It appears to function in a feedback loop system with caspases. BCL2 inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and\/or by binding to the apoptosis-activating factor (APAF-1) (PMID: 10444588).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3508 Product name: Recombinant human BCL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-239 aa of BC027258 Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK Predict reactive species\nFull Name: B-cell CLL\/lymphoma 2\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC027258\nGene Symbol: BCL2\nGene ID (NCBI): 596\nRRID: AB_2918886\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P10415\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888346681513,"sku":"80313-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-80313-1-rr","provider":"Iright","version":"1.0","type":"link"}