{"product_id":"proteintech-80325-6-rr","title":"Proteintech, 80325-6-RR, XRCC5\/Ku80 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe XRCC5\/Ku80 (80325-6-RR) by Proteintech is a Recombinant antibody targeting XRCC5\/Ku80 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n80325-6-RR targets XRCC5\/Ku80 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG cells,  HEK-293 cells,  A549 cells,  K-562 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThere are at least two pathways for eukaryotes to repair DNA double-strand breaks: homologous recombination and nonhomologous end joining(NHEJ). The core NHEJ machinery includes XRCC4, DNA ligase IV and the DNA-dependent protein kinase complex, which consists of the DNA end-binding XRCC5\/XRCC6 heterodimer and the catalytic subunit PRKDC. The heterdimer of XRCC5\/XRCC6 enhanced teh affinity of the catalytic subunit PRKDC to DNA by 100-fold.  Once the XRCC5\/6 dimer association with NAA15, it can bind to the osteocalcin promoter and activate osteocalcin expression. The XRCC5\/6 dimer acts as a negative regulator of transcription when together with APEX1. Some publised papers indicated that the MW of XRCC5 is 86kDa, while more papers suggested that XRCC5 is a 80kDa protein, as it was firstly introducted in publication.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag9454 Product name: Recombinant human XRCC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 384-732 aa of BC019027 Sequence: LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI Predict reactive species\nFull Name: X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)\nCalculated Molecular Weight: 732 aa, 83 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC019027\nGene Symbol: XRCC5\nGene ID (NCBI): 7520\nRRID: AB_3670474\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P13010\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888381317289,"sku":"80325-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-80325-6-rr","provider":"Iright","version":"1.0","type":"link"}