Proteintech, 80670-2-RR, PTPN6/SHP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The PTPN6/SHP1 (80670-2-RR) by Proteintech is a Recombinant antibody targeting PTPN6/SHP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 80670-2-RR targets PTPN6/SHP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, Raji cells, THP-1 cells, Jurkat cells, mouse spleen tissue, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information PTPN6(Tyrosine-protein phosphatase non-receptor type 6) is also named as HCP, PTP1C and belongs to the protein-tyrosine phosphatase family. It regulates muscle INS action in a cell-autonomous manner, further suggesting that the PTPase negatively modulates INS action through down-regulation of both INS signaling to AKT1 and SLC2A4 translocation, as well as SLC2A4 expression(PMID:21952243). It has 4 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21415 Product name: Recombinant human PTPN6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 506-598 aa of BC002523 Sequence: QYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK Predict reactive species Full Name: protein tyrosine phosphatase, non-receptor type 6 Calculated Molecular Weight: 597 aa, 68 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC002523 Gene Symbol: PTPN6/SHP1 Gene ID (NCBI): 5777 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P29350 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.