{"product_id":"proteintech-80670-2-rr","title":"Proteintech, 80670-2-RR, PTPN6\/SHP1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PTPN6\/SHP1 (80670-2-RR) by Proteintech is a Recombinant antibody targeting PTPN6\/SHP1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n80670-2-RR targets PTPN6\/SHP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, Raji cells,  THP-1 cells,  Jurkat cells,  mouse spleen tissue,  rat spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTPN6(Tyrosine-protein phosphatase non-receptor type 6) is also named as HCP, PTP1C and belongs to the protein-tyrosine phosphatase family. It regulates muscle INS action in a cell-autonomous manner, further suggesting that the PTPase negatively modulates INS action through down-regulation of both INS signaling to AKT1 and SLC2A4 translocation, as well as SLC2A4 expression(PMID:21952243). It has 4 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag21415 Product name: Recombinant human PTPN6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 506-598 aa of BC002523 Sequence: QYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK Predict reactive species\nFull Name: protein tyrosine phosphatase, non-receptor type 6\nCalculated Molecular Weight: 597 aa, 68 kDa\nObserved Molecular Weight: 63 kDa\nGenBank Accession Number: BC002523\nGene Symbol: PTPN6\/SHP1\nGene ID (NCBI): 5777\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P29350\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888812019881,"sku":"80670-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-80670-2-rr","provider":"Iright","version":"1.0","type":"link"}