{"product_id":"proteintech-80979-1-rr","title":"Proteintech, 80979-1-RR, NF-κB p65 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NF-κB p65 (80979-1-RR) by Proteintech is a Recombinant antibody targeting NF-κB p65 in WB, IF\/ICC, FC (Intra), IP, ELISA, ChIP-qPCR applications with reactivity to human, mouse, rat samples\n80979-1-RR targets NF-κB p65 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  MCF-7 cells,  MOLT-4 cells,  Jurkat cells,  Raji cells,  NIH\/3T3 cells,  HSC-T6 cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HepG2 cells, TNF alpha treated HT-1080 cells\nPositive FC (Intra) detected in: HepG2 cells\nPositive ChIP-qPCR detected in: hTNF-α-HeLa, 30 ng\/ml, 1 h HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:40000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\nCHIP-QPCR: CHIP-QPCR : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNuclear factor kB (NF-kB) is a sequence-specific DNA-binding protein complex which regulates the expression of viral genomes, including the human immunodeficiency virus, and a variety of cellular genes, particularly those involved in immune and inflammatory responses. The members of the NF-kB family in mammalian cells include the proto-oncogene c-Rel,p50\/p105 (NFkB1), p65 (RelA), p52\/p100 (NFkB2), and RelB. All of these proteins share a conserved 300-amino acid region known as the Rel homology domain which is responsible for DNA binding, dimerization, and nuclear translocation of NF-kB. The p65 subunit is a major component of NF-kB complexes and is responsible for trans-activation. NF-kB heterodimeric p65-p50 and p65-c-Rel complexes are transcriptional activators. The NF-kB p65-p65 complex appears to be involved in invasin-mediated activation of IL-8 expression. The inhibitory effect of IkB upon NF-kB the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kB complex. It associates with chromatin at the NF-kB promoter region via association with DDX1. This antibody is a rabbit monoclonal antibody raised against residues near the N terminus of human RELA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1199 Product name: Recombinant human p65; RELA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-220 aa of BC011603 Sequence: MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ Predict reactive species\nFull Name: v-rel reticuloendotheliosis viral oncogene homolog A (avian)\nCalculated Molecular Weight: 65 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC011603\nGene Symbol: NF-κB p65\nGene ID (NCBI): 5970\nRRID: AB_2918923\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q04206\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888339374249,"sku":"80979-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-80979-1-rr","provider":"Iright","version":"1.0","type":"link"}