Proteintech, 81066-1-RR, Band 3/AE 1 Recombinant monoclonal antibody

Size: 20ul / 100ul The Band 3/AE 1 (81066-1-RR) by Proteintech is a Recombinant antibody targeting Band 3/AE 1 in IHC, IF-P, ELISA applications with reactivity to human samples 81066-1-RR targets Band 3/AE 1 in IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:800-1:3200 Background Information Anion exchanger 1 (AE1), also known as band 3, is a 95-100 kDa transmembrane glycoprotein which is abundantly expressed in erythrocyte plasma membrane and mediates the electroneutral exchange of Cl- and HCO3-. It contains a 52-55 kDa C-terminal membrane crossing domain and a 43 kDa N-terminal cytoplasmic domain. Degradation of band 3 protein occurred during erythrocyte aging. The oxidative stress can also activate the proteolysis of band 3 through caspases. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27878 Product name: Recombinant human SLC4A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC101570 Sequence: MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLF Predict reactive species Full Name: solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group) Calculated Molecular Weight: 911 aa, 102 kDa GenBank Accession Number: BC101570 Gene Symbol: band 3 Gene ID (NCBI): 6521 RRID: AB_2935547 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02730 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.