{"product_id":"proteintech-81069-1-rr","title":"Proteintech, 81069-1-RR, FGFR4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FGFR4 (81069-1-RR) by Proteintech is a Recombinant antibody targeting FGFR4 in WB, IHC, ELISA applications with reactivity to human samples\n81069-1-RR targets FGFR4 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MOLT-4 cells, HepG2 cells,  Raji cells,  Jurkat cells,  HeLa cells,  HT-29 cells,  A549 cells\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag31013 Product name: Recombinant human FGFR4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 742-802 aa of BC011847 Sequence: ALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSFPFGSGVQT Predict reactive species\nFull Name: fibroblast growth factor receptor 4\nCalculated Molecular Weight: 88 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC011847\nGene Symbol: FGFR4\nGene ID (NCBI): 2264\nRRID: AB_2918926\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P22455\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888636743849,"sku":"81069-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-81069-1-rr","provider":"Iright","version":"1.0","type":"link"}