{"product_id":"proteintech-81340-1-rr","title":"Proteintech, 81340-1-RR, YTHDF2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe YTHDF2 (81340-1-RR) by Proteintech is a Recombinant antibody targeting YTHDF2 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n81340-1-RR targets YTHDF2 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells,  HeLa cells,  Raji cells,  NIH\/3T3 cells,  RAW 264.7 cells,  C6 cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: sodium arsenite treated HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYTHDF2, also named as YTH domain-containing family protein 2, is a 579 amino acid protein, which contains 1 YTH domain. YTHDF2 specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, and regulates mRNA stability. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability. YTHDF2 acts as a regulator of mRNA stability: binding to m6A-containing mRNAs results in the localization to mRNA decay sites, such as processing bodies (P-bodies), leading to mRNA degradation. YTHDF2 also acts as a promoter of cap-independent mRNA translation following heat shock stress: upon stress, relocalizes to the nucleus and specifically binds mRNAs with some m6A methylation mark at their 5'-UTR, protecting demethylation of mRNAs by FTO, thereby promoting cap-independent mRNA translation. The calculated molecular weight of YTHDF2 is 62 kDa, but the phosphorylated YTHDF2 is about 65-70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5922 Product name: Recombinant human YTHDF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 339-565 aa of BC002559 Sequence: LSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQE Predict reactive species\nFull Name: YTH domain family, member 2\nCalculated Molecular Weight: 62 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC002559\nGene Symbol: YTHDF2\nGene ID (NCBI): 51441\nRRID: AB_2923715\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y5A9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888343863465,"sku":"81340-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-81340-1-rr","provider":"Iright","version":"1.0","type":"link"}