{"product_id":"proteintech-81373-8-rr","title":"Proteintech, 81373-8-RR, CDKN2A\/P16-INK4A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CDKN2A\/P16-INK4A (81373-8-RR) by Proteintech is a Recombinant antibody targeting CDKN2A\/P16-INK4A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n81373-8-RR targets CDKN2A\/P16-INK4A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  TF-1 cells,  SiHa cells\nPositive IHC detected in: human cervical cancer tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDKN2A generates several transcript variants which differ in their first exons. At least three alternatively-spliced variants encoding distinct proteins proteins were reported. Two of them named p16-INK4 and p14 are sharing 50% identity. P16 plays an essential role in regulating the cell cycle, and mutations in p16 increase the risk of developing various cancers, including melanoma. Long-term p16(INK4a) expression pushes cells to enter senescence, an irreversible cell-cycle arrest that precludes the growth of would-be cancer cells but also contributes to cellular aging (PMID: 24136988).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1328 Product name: Recombinant human P16-INK4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-156 aa of BC021998 Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD Predict reactive species\nFull Name: cyclin-dependent kinase inhibitor 2A\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC021998\nGene Symbol: CDKN2A\nGene ID (NCBI): 1029\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P42771\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888725020841,"sku":"81373-8-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-81373-8-rr","provider":"Iright","version":"1.0","type":"link"}